PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02877.40
Common NameJCGZ_11997
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MIKC_MADS
Protein Properties Length: 349aa    MW: 39774.7 Da    PI: 5.9494
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02877.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.92.3e-27958150
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                   krien +nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++g+l  +s
  Jcr4S02877.40  9 KRIENITNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSGRLSHFS 58
                   79********************************************9997 PP

2K-box23.52.3e-091211881077
          K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqi 77 
                     +++ e+lq+e+a L+++++  ++++R +  + L+  s+ eL++ e++L + l+++ ++K+ ll +q+
  Jcr4S02877.40 121 LNSDIEELQHEVASLQQQLHITEEQIRIYEPDPLKITSMGELESCEKHLVDTLTSVMQRKEYLLSSQL 188
                    567899**********************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.674161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-29282IPR002100Transcription factor, MADS-box
CDDcd002655.22E-36275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-26323IPR002100Transcription factor, MADS-box
PfamPF003192.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-263859IPR002100Transcription factor, MADS-box
PfamPF014868.1E-6124188IPR002487Transcription factor, K-box
PROSITE profilePS512976.57125232IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGRVKLEIKR IENITNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SGRLSHFSGK  60
KRIEDVFARY VNLPDQEREH AVCPENKRHP DFQNKEYLLR TLQQLKSEND IALQLVNPTA  120
LNSDIEELQH EVASLQQQLH ITEEQIRIYE PDPLKITSMG ELESCEKHLV DTLTSVMQRK  180
EYLLSSQLGF DPTMQQGMPN SFENDVINWM PESSQNHVQM RCQNHQQMFD ASASLNSLRD  240
LSSTIYDPLL QGSSSNGEAH SMGDCHVSNP NDGNFSNWHH QSYASTTLHS APMPTTVLYS  300
HQVQHGMVGQ SIPEMMPREQ MEMAMSGPHA KVENEAANYD NKVPQLNGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-15158158Myocyte-specific enhancer factor 2B
1tqe_Q2e-15158158Myocyte-specific enhancer factor 2B
1tqe_R2e-15158158Myocyte-specific enhancer factor 2B
1tqe_S2e-15158158Myocyte-specific enhancer factor 2B
3mu6_A7e-16270168Myocyte-specific enhancer factor 2A
3mu6_B7e-16270168Myocyte-specific enhancer factor 2A
3mu6_C7e-16270168Myocyte-specific enhancer factor 2A
3mu6_D7e-16270168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078348.10.0PREDICTED: agamous-like MADS-box protein AGL11
SwissprotQ9LM461e-129AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLA0A067KKD90.0A0A067KKD9_JATCU; Uncharacterized protein
STRINGPOPTR_0002s09290.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85252735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-130AGAMOUS-like 104
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]